Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1QL3 Rabbit Polyclonal Antibody (FITC)

C1QL3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C1ql, K100, CTRP13, C1QTNF13

UniProt

Q5VWW1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human C1QL3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VPKIAFYAGLKRQHEGYEVLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001010908

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human HLA class I histocompatibility antigen, B-8 alpha chain (HLA-B), partial
MBS1013861-01 0.5 mg (E-Coli)

Recombinant Human HLA class I histocompatibility antigen, B-8 alpha chain (HLA-B), partial

Sign In for Pricing
View Details
Recombinant Human HLA class I histocompatibility antigen, B-8 alpha chain (HLA-B), partial
MBS1013861-02 0.05 mg (Baculovirus)

Recombinant Human HLA class I histocompatibility antigen, B-8 alpha chain (HLA-B), partial

Sign In for Pricing
View Details
Recombinant Human HLA class I histocompatibility antigen, B-8 alpha chain (HLA-B), partial
MBS1013861-03 0.5 mg (Yeast)

Recombinant Human HLA class I histocompatibility antigen, B-8 alpha chain (HLA-B), partial

Sign In for Pricing
View Details
Recombinant Human HLA class I histocompatibility antigen, B-8 alpha chain (HLA-B), partial
MBS1013861-04 0.05 mg (Mammalian-Cell)

Recombinant Human HLA class I histocompatibility antigen, B-8 alpha chain (HLA-B), partial

Sign In for Pricing
View Details
Recombinant Human HLA class I histocompatibility antigen, B-8 alpha chain (HLA-B), partial
MBS1013861-05 1 mg (E-Coli)

Recombinant Human HLA class I histocompatibility antigen, B-8 alpha chain (HLA-B), partial

Sign In for Pricing
View Details
Recombinant Human HLA class I histocompatibility antigen, B-8 alpha chain (HLA-B), partial
MBS1013861-06 0.1 mg (Baculovirus)

Recombinant Human HLA class I histocompatibility antigen, B-8 alpha chain (HLA-B), partial

Sign In for Pricing
View Details