Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C3orf26 Rabbit Polyclonal Antibody (FITC)

C3orf26 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C3orf26

UniProt

B4DUM1

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human C3orf26

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EASDGEGEGDTEVMQQETVPVPVPSEKTKQPKECFLIQPKERKENTTKTR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001161396

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Phlda3 Pre-designed siRNA Set B
SI210423B 1 Each

Rat Phlda3 Pre-designed siRNA Set B

Sign In for Pricing
View Details
SOX3 (NM_005634) Human Tagged Lenti ORF Clone
RC210859L4 10 µg

SOX3 (NM_005634) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TNFRSF10A, CT (TNFRSF10A, APO2, DR4, TRAILR1, Tumor necrosis factor receptor superfamily member 10A, Death receptor 4, TNF-related apoptosis-inducing ligand receptor 1, CD261) (PE)
MBS6356899-01 0.2 mL

TNFRSF10A, CT (TNFRSF10A, APO2, DR4, TRAILR1, Tumor necrosis factor receptor superfamily member 10A, Death receptor 4, TNF-related apoptosis-inducing ligand receptor 1, CD261) (PE)

Sign In for Pricing
View Details
TNFRSF10A, CT (TNFRSF10A, APO2, DR4, TRAILR1, Tumor necrosis factor receptor superfamily member 10A, Death receptor 4, TNF-related apoptosis-inducing ligand receptor 1, CD261) (PE)
MBS6356899-02 5x 0.2 mL

TNFRSF10A, CT (TNFRSF10A, APO2, DR4, TRAILR1, Tumor necrosis factor receptor superfamily member 10A, Death receptor 4, TNF-related apoptosis-inducing ligand receptor 1, CD261) (PE)

Sign In for Pricing
View Details
DR5 Rabbit monoclonal antibody
orb2297872-01 25 µL

DR5 Rabbit monoclonal antibody

Sign In for Pricing
View Details
DR5 Rabbit monoclonal antibody
orb2297872-02 50 µL

DR5 Rabbit monoclonal antibody

Sign In for Pricing
View Details