Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAPCD1 Rabbit Polyclonal Antibody (FITC)

SAPCD1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

NG23, C6orf26

UniProt

Q5SSQ6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SAPCD1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NLIHEKFSPSPLNKASSCTTQDSKERRREQNLWQQQELSRQQKGVTQPKE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human

Tested Applications

WB

NCBI Accession Number

NP_001034740

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human FCGR3B shRNA (UAS) - Lentiviral human FCGR3B shRNA (UAS, RFP) (100)
GTR15137820 1 Vial

Lentiviral human FCGR3B shRNA (UAS) - Lentiviral human FCGR3B shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Mouse C-C motif chemokine 25 ELISA Kit
MBS2883078-01 48 Well

Mouse C-C motif chemokine 25 ELISA Kit

Sign In for Pricing
View Details
Mouse C-C motif chemokine 25 ELISA Kit
MBS2883078-02 96 Well

Mouse C-C motif chemokine 25 ELISA Kit

Sign In for Pricing
View Details
Mouse C-C motif chemokine 25 ELISA Kit
MBS2883078-03 5x 96 Well

Mouse C-C motif chemokine 25 ELISA Kit

Sign In for Pricing
View Details
Mouse C-C motif chemokine 25 ELISA Kit
MBS2883078-04 10x 96 Well

Mouse C-C motif chemokine 25 ELISA Kit

Sign In for Pricing
View Details
SNCAIP Rabbit Polyclonal Antibody (HRP)
orb2082410 100 µL

SNCAIP Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details