Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C7orf57 Rabbit Polyclonal Antibody (HRP)

C7orf57 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q8NEG2

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human C7orf57

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EKAVDAPPASQIPGLSNLGDSHSENLPGTRRYWIKETDSEYVKLAKQGGR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001093629

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr637 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV637781 1.0 µg DNA

Olr637 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Sheep Epithelial Cell Adhesion Molecule ELISA Kit
MBS024272-01 48 Well

Sheep Epithelial Cell Adhesion Molecule ELISA Kit

Sign In for Pricing
View Details
Sheep Epithelial Cell Adhesion Molecule ELISA Kit
MBS024272-02 96 Well

Sheep Epithelial Cell Adhesion Molecule ELISA Kit

Sign In for Pricing
View Details
Sheep Epithelial Cell Adhesion Molecule ELISA Kit
MBS024272-03 5x 96 Well

Sheep Epithelial Cell Adhesion Molecule ELISA Kit

Sign In for Pricing
View Details
Sheep Epithelial Cell Adhesion Molecule ELISA Kit
MBS024272-04 10x 96 Well

Sheep Epithelial Cell Adhesion Molecule ELISA Kit

Sign In for Pricing
View Details
Chicken Ras-related protein Rab-14 ELISA Kit
MBS2883497-01 48 Well

Chicken Ras-related protein Rab-14 ELISA Kit

Sign In for Pricing
View Details