Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IDNK Rabbit Polyclonal Antibody (Biotin)

IDNK Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HGntK, C9orf103, bA522I20.2

UniProt

Q5T6J7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human IDNK

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RVVLACSALKKTYRDILTQGKDGVALKCEESGKEAKQAEMQLLVVHLSGS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Horse Nuclear Receptor Subfamily 1, Group D, Member 2 ELISA Kit
MBS106489-01 48 Well

Horse Nuclear Receptor Subfamily 1, Group D, Member 2 ELISA Kit

Sign In for Pricing
View Details
Horse Nuclear Receptor Subfamily 1, Group D, Member 2 ELISA Kit
MBS106489-02 96 Well

Horse Nuclear Receptor Subfamily 1, Group D, Member 2 ELISA Kit

Sign In for Pricing
View Details
Horse Nuclear Receptor Subfamily 1, Group D, Member 2 ELISA Kit
MBS106489-03 5x 96 Well

Horse Nuclear Receptor Subfamily 1, Group D, Member 2 ELISA Kit

Sign In for Pricing
View Details
Horse Nuclear Receptor Subfamily 1, Group D, Member 2 ELISA Kit
MBS106489-04 10x 96 Well

Horse Nuclear Receptor Subfamily 1, Group D, Member 2 ELISA Kit

Sign In for Pricing
View Details
Goat Crumbs homolog 1 (CRB1) ELISA Kit
MBS7210641-01 48 Well

Goat Crumbs homolog 1 (CRB1) ELISA Kit

Sign In for Pricing
View Details
Goat Crumbs homolog 1 (CRB1) ELISA Kit
MBS7210641-02 96 Well

Goat Crumbs homolog 1 (CRB1) ELISA Kit

Sign In for Pricing
View Details