Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IDNK Rabbit Polyclonal Antibody (FITC)

IDNK Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HGntK, C9orf103, bA522I20.2

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human IDNK

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LLASELGWKFYDADDYHPEENRRKMGKGIPLNDQDRIPWLCNLHDILLRD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001001551

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CF®555 Goat Anti-Mouse IgM (Mu Chain), 2mg/mL
#20485-250uL 1x 250 µL

CF®555 Goat Anti-Mouse IgM (Mu Chain), 2mg/mL

Sign In for Pricing
View Details
GPT ELISA Kit (Mouse) (OKCD06133)
OKCD06133 96 Well

GPT ELISA Kit (Mouse) (OKCD06133)

Sign In for Pricing
View Details
Lentiviral mouse Hsf4 shRNA (UAS) - Lentiviral mouse Hsf4 shRNA (UAS, RFP) (25)
GTR15162023 1 Vial

Lentiviral mouse Hsf4 shRNA (UAS) - Lentiviral mouse Hsf4 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Human recombinant HDGF (Hepatoma-derived growth factor) protein, AF
PROTP51858-2-5ug 5 µg

Human recombinant HDGF (Hepatoma-derived growth factor) protein, AF

Sign In for Pricing
View Details
TCERG1L sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
46374111 3x 1.0 µg

TCERG1L sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
C-Jun (JUN) Mouse Monoclonal Antibody [Clone 7H5]
E45M14692V-2 50 µL

C-Jun (JUN) Mouse Monoclonal Antibody [Clone 7H5]

Sign In for Pricing
View Details