Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IDNK Rabbit Polyclonal Antibody (FITC)

IDNK Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HGntK, C9orf103, bA522I20.2

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human IDNK

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LLASELGWKFYDADDYHPEENRRKMGKGIPLNDQDRIPWLCNLHDILLRD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001001551

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmu-miR-7042-5p mimic
HY-R03827-01 5 nmol

Mmu-miR-7042-5p mimic

Sign In for Pricing
View Details
Mmu-miR-7042-5p mimic
HY-R03827-02 20 nmol

Mmu-miR-7042-5p mimic

Sign In for Pricing
View Details
Human CD25/IL2RA Antibody , FITC
E55A07021 50 Tests

Human CD25/IL2RA Antibody , FITC

Sign In for Pricing
View Details
P2OX Goat Polyclonal Antibody
TA396702S 25 µL

P2OX Goat Polyclonal Antibody

Sign In for Pricing
View Details
EYA3 Rabbit pAb
E47R12382 100 µL

EYA3 Rabbit pAb

Sign In for Pricing
View Details
Ultrasonic Cleaners; Ultrasonic Bath; Ultrasonic Cleaning; Ultrasonics Processor
E0443 1 Unit

Ultrasonic Cleaners; Ultrasonic Bath; Ultrasonic Cleaning; Ultrasonics Processor

Sign In for Pricing
View Details