Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TOR4A Rabbit Polyclonal Antibody (HRP)

TOR4A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C9orf167

UniProt

Q9NXH8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TOR4A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QYHARHHCPEARAAQDCREELARRVADVVARAEAEEKTPLLVLDDVELMP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_060193

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protein Gene Product 9.5 (PGP9.5, Ubiquitin CT Hydrolase L1, UCH, UCHL1, Ubiquitin thiolesterase, PARK5) (FITC)
P9102-70A1-FITC 100 µL

Protein Gene Product 9.5 (PGP9.5, Ubiquitin CT Hydrolase L1, UCH, UCHL1, Ubiquitin thiolesterase, PARK5) (FITC)

Sign In for Pricing
View Details
Chicken Ly6/PLAUR domain-containing protein 1 (LYPD1) ELISA Kit
MBS7203118-01 48 Well

Chicken Ly6/PLAUR domain-containing protein 1 (LYPD1) ELISA Kit

Sign In for Pricing
View Details
Chicken Ly6/PLAUR domain-containing protein 1 (LYPD1) ELISA Kit
MBS7203118-02 96 Well

Chicken Ly6/PLAUR domain-containing protein 1 (LYPD1) ELISA Kit

Sign In for Pricing
View Details
Chicken Ly6/PLAUR domain-containing protein 1 (LYPD1) ELISA Kit
MBS7203118-03 5x 96 Well

Chicken Ly6/PLAUR domain-containing protein 1 (LYPD1) ELISA Kit

Sign In for Pricing
View Details
Chicken Ly6/PLAUR domain-containing protein 1 (LYPD1) ELISA Kit
MBS7203118-04 10x 96 Well

Chicken Ly6/PLAUR domain-containing protein 1 (LYPD1) ELISA Kit

Sign In for Pricing
View Details
C9orf4 Peptide - middle region
orb2015359 100 µg

C9orf4 Peptide - middle region

Sign In for Pricing
View Details