Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C10orf90 Rabbit Polyclonal Antibody (FITC)

C10orf90 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FATS, bA422P15.2

UniProt

Q96M02

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human C10orf90

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QDVCASLQEDNGVQIESKFPKGDYTCCDLVVKIKECKKSEDPTTPEPSPA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001004298

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Frs3 shRNA (UAS) - Lentiviral mouse Frs3 shRNA (UAS, RFP) (100)
GTR15187020 1 Vial

Lentiviral mouse Frs3 shRNA (UAS) - Lentiviral mouse Frs3 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
CCNDBP1, NT (CCNDBP1, DIP1, GCIP, HHM, Cyclin-D1-binding protein 1, Grap2 and cyclin-D-interacting protein, Human homolog of Maid) (MaxLight 650) discontinued
033406-ML650 100 µL

CCNDBP1, NT (CCNDBP1, DIP1, GCIP, HHM, Cyclin-D1-binding protein 1, Grap2 and cyclin-D-interacting protein, Human homolog of Maid) (MaxLight 650) discontinued

Sign In for Pricing
View Details
THOC5 Rabbit Polyclonal Antibody
orb1474673-01 30 µL

THOC5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
THOC5 Rabbit Polyclonal Antibody
orb1474673-02 50 μL

THOC5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
THOC5 Rabbit Polyclonal Antibody
orb1474673-03 100 µL

THOC5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
THOC5 Rabbit Polyclonal Antibody
orb1474673-04 200 µL

THOC5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details