Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C11orf1 Rabbit Polyclonal Antibody (FITC)

C11orf1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q9H5F2

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human C11orf1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TYDTSYNNKMPLSTHRFKREPHWFPGHQPELDPPRYKCTEKSTYMNSYSK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_073598

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rasgrp1 Mouse shRNA Lentiviral Particle (Locus ID 19419)
TL516081V 500 µL Each

Rasgrp1 Mouse shRNA Lentiviral Particle (Locus ID 19419)

Sign In for Pricing
View Details
Reagecon 0.5 mg/L C Sucrose Rs Total Organic Carbon (TOC) Standard for Sievers Checkpoint Analyser
ISTOC1321 40 mL

Reagecon 0.5 mg/L C Sucrose Rs Total Organic Carbon (TOC) Standard for Sievers Checkpoint Analyser

Sign In for Pricing
View Details
MEST (Mesoderm Specific Transcript Homolog, PEG1) discontinued
211974-01 50 µL

MEST (Mesoderm Specific Transcript Homolog, PEG1) discontinued

Sign In for Pricing
View Details
MEST (Mesoderm Specific Transcript Homolog, PEG1) discontinued
211974-02 100 µL

MEST (Mesoderm Specific Transcript Homolog, PEG1) discontinued

Sign In for Pricing
View Details
MEST (Mesoderm Specific Transcript Homolog, PEG1) discontinued
211974-03 200 µL

MEST (Mesoderm Specific Transcript Homolog, PEG1) discontinued

Sign In for Pricing
View Details
Human PCDHB14 shRNA Plasmid
abx961065-01 150 µg

Human PCDHB14 shRNA Plasmid

Sign In for Pricing
View Details