Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CFAP300 Rabbit Polyclonal Antibody (HRP)

CFAP300 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FBB5, CILD38, C11orf70

UniProt

Q9BRQ4

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human C11orf70

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LIYKDLVSVRKNPQTKKIQITSSVFKVSAYDSAGMCYPSAKNHEQTFSYF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_116319

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EMC8 Antibody, HRP conjugated
A17917-100UG 100 µg

EMC8 Antibody, HRP conjugated

Sign In for Pricing
View Details
Perld1 ORF Vector (Rat) (pORF)
36394016 1.0 µg DNA

Perld1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
DUSP4 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-1852R-BF750-01 20 µL

DUSP4 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
DUSP4 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-1852R-BF750-02 100 µL

DUSP4 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
MRPL55 Human qPCR Template Standard (NM_181441)
HK212274 1 Kit

MRPL55 Human qPCR Template Standard (NM_181441)

Sign In for Pricing
View Details
POLR3A Protein Vector (Mouse) (pPB-N-His)
PV217871 500 ng

POLR3A Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details