Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CFAP300 Rabbit Polyclonal Antibody (HRP)

CFAP300 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FBB5, CILD38, C11orf70

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human C11orf70

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ELRRVLLVEDSEKYEIFSQPDREEFLFCLFKHLCLGGALCQYEDVISPYL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_116319

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-485-5p agomir
HY-R01455A-01 5 nmol

Hsa-miR-485-5p agomir

Sign In for Pricing
View Details
Hsa-miR-485-5p agomir
HY-R01455A-02 20 nmol

Hsa-miR-485-5p agomir

Sign In for Pricing
View Details
Human ACTG2 knockdown cell line
ABC-KD0204 1 Vial

Human ACTG2 knockdown cell line

Sign In for Pricing
View Details
Rgl3 (NM_023622) Mouse Recombinant Protein
PM43824M5 20 µg

Rgl3 (NM_023622) Mouse Recombinant Protein

Sign In for Pricing
View Details
({ (E) -[1- (2-Thienyl) ethylidene]amino}oxy) acetic acid
OR1003493-01 50 mg

({ (E) -[1- (2-Thienyl) ethylidene]amino}oxy) acetic acid

Sign In for Pricing
View Details
({ (E) -[1- (2-Thienyl) ethylidene]amino}oxy) acetic acid
OR1003493-02 250 mg

({ (E) -[1- (2-Thienyl) ethylidene]amino}oxy) acetic acid

Sign In for Pricing
View Details