Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PARPBP Rabbit Polyclonal Antibody (HRP)

PARPBP Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AROM, PARI, C12orf48

UniProt

Q9NWS1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human PARPBP

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YMENDLSEGVNPSVGRSTIGTSFGNVHLDRSKNEKVSRKSTSQTGNKSSK

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-outer-membrane porin C antibody ELISA kit
GTR10435653 96 Well

Rabbit anti-outer-membrane porin C antibody ELISA kit

Sign In for Pricing
View Details
Rat FABP2 shRNA Plasmid
abx985152-01 150 µg

Rat FABP2 shRNA Plasmid

Sign In for Pricing
View Details
Rat FABP2 shRNA Plasmid
abx985152-02 300 µg

Rat FABP2 shRNA Plasmid

Sign In for Pricing
View Details
Anti-human PDCD1 / PD-1 / CD279 (Iparomlimab Biosimilar)
BIO0596SM-20mg 20 mg

Anti-human PDCD1 / PD-1 / CD279 (Iparomlimab Biosimilar)

Sign In for Pricing
View Details
FKBP51 (FKBP5) (NM_001145775) Human Recombinant Protein
E45H31455E1 50 µg

FKBP51 (FKBP5) (NM_001145775) Human Recombinant Protein

Sign In for Pricing
View Details
Human Guanine nucleotide-binding protein G (I)/G (S)/G (T) subunit beta-1 (GNB1) ELISA Kit
MBS166965-01 48 Well

Human Guanine nucleotide-binding protein G (I)/G (S)/G (T) subunit beta-1 (GNB1) ELISA Kit

Sign In for Pricing
View Details