Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PARPBP Rabbit Polyclonal Antibody (HRP)

PARPBP Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AROM, PARI, C12orf48

UniProt

Q9NWS1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human PARPBP

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NEPPQHKNAKIPKKSNDSQNRLYGKLAKVAKSNKCTAKDKLISGQAKLTQ

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bordetella Parapertussis leuC Protein (aa 1-467)
VAng-Lsx4624-500gEcoli 500 µg (E. coli)

Recombinant Bordetella Parapertussis leuC Protein (aa 1-467)

Sign In for Pricing
View Details
USF2 (Upstream Transcription Factor 2, c-fos Interacting, FIP, bHLHb12) (APC)
MBS6168001-01 0.1 mL

USF2 (Upstream Transcription Factor 2, c-fos Interacting, FIP, bHLHb12) (APC)

Sign In for Pricing
View Details
USF2 (Upstream Transcription Factor 2, c-fos Interacting, FIP, bHLHb12) (APC)
MBS6168001-02 5x 0.1 mL

USF2 (Upstream Transcription Factor 2, c-fos Interacting, FIP, bHLHb12) (APC)

Sign In for Pricing
View Details
NCRNA00092 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1402108 1.0 µg DNA

NCRNA00092 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Human NGFI-A-binding protein 2 (NAB2) ELISA Kit
abx534400 96 Tests

Human NGFI-A-binding protein 2 (NAB2) ELISA Kit

Sign In for Pricing
View Details
KAT7 Antibody - middle region
MBS3220007-01 0.1 mL

KAT7 Antibody - middle region

Sign In for Pricing
View Details