Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C12orf56 Rabbit Polyclonal Antibody (FITC)

C12orf56 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human C12orf56

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RDVVAIDLIDDYPEFLSSPDREISQHIRIIYSSTVLKKECKKSNSVRKFL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_001093146

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dacomitinib hydrate 50mg
A24173-50 50 mg

Dacomitinib hydrate 50mg

Sign In for Pricing
View Details
Human Succinate Dehydrogenase Complex Subunit C (SDHC) ELISA Kit
orb2812019-01 48 Tests

Human Succinate Dehydrogenase Complex Subunit C (SDHC) ELISA Kit

Sign In for Pricing
View Details
Human Succinate Dehydrogenase Complex Subunit C (SDHC) ELISA Kit
orb2812019-02 96 Tests

Human Succinate Dehydrogenase Complex Subunit C (SDHC) ELISA Kit

Sign In for Pricing
View Details
Human Succinate Dehydrogenase Complex Subunit C (SDHC) ELISA Kit
orb2812019-03 5 x 96 T

Human Succinate Dehydrogenase Complex Subunit C (SDHC) ELISA Kit

Sign In for Pricing
View Details
NRG3 (NM_001165972) Human Tagged Lenti ORF Clone
RC228998L4 10 µg

NRG3 (NM_001165972) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SIAH-2 Double Nickase Plasmid (m2)
sc-422932-NIC-2 20 µg

SIAH-2 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details