Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C12orf56 Rabbit Polyclonal Antibody (HRP)

C12orf56 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human C12orf56

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RDVVAIDLIDDYPEFLSSPDREISQHIRIIYSSTVLKKECKKSNSVRKFL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_001093146

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Colon
CS715429 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
Recombinant Human IL2RG/CD132 Protein (aa 1-254, Fc Tag)
PKSH031531-01 100 µg

Recombinant Human IL2RG/CD132 Protein (aa 1-254, Fc Tag)

Sign In for Pricing
View Details
Recombinant Human IL2RG/CD132 Protein (aa 1-254, Fc Tag)
PKSH031531-02 1 mg

Recombinant Human IL2RG/CD132 Protein (aa 1-254, Fc Tag)

Sign In for Pricing
View Details
STAT5B (STAT5B/2657), CF405S conjugate, 0.1mg/mL
BNC042657-500 1x 500 µL

STAT5B (STAT5B/2657), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Testis
CR562815 5 µg

Tissue Total RNA, Testis

Sign In for Pricing
View Details
Human MUC17 activation kit by CRISPRa
GA115361 1 Kit

Human MUC17 activation kit by CRISPRa

Sign In for Pricing
View Details