Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TEFM Rabbit Polyclonal Antibody (FITC)

TEFM Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C17orf42

UniProt

Q96QE5

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human TEFM

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RSSLYWALHNFCCRKKSTTPKKITPNVTFCDENAKEPENALDKLFSSEQQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Porcine

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L2HGDH Human Pre-designed siRNA Set A
HY-RS07483 1 Set

L2HGDH Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Buffer Solution Concentrate pH 4.0 ±0.02 @ 20 °c (Citrate/ Hydrochloric Acid) for 500 ml Buffer Solution
B0021 03AMP 3 Amp

Buffer Solution Concentrate pH 4.0 ±0.02 @ 20 °c (Citrate/ Hydrochloric Acid) for 500 ml Buffer Solution

Sign In for Pricing
View Details
Guinea pig Kruppel Like Factor 2 (KLF2) ELISA Kit
MBS2602107-01 48 Well

Guinea pig Kruppel Like Factor 2 (KLF2) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Kruppel Like Factor 2 (KLF2) ELISA Kit
MBS2602107-02 96 Well

Guinea pig Kruppel Like Factor 2 (KLF2) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Kruppel Like Factor 2 (KLF2) ELISA Kit
MBS2602107-03 5x 96 Well

Guinea pig Kruppel Like Factor 2 (KLF2) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Kruppel Like Factor 2 (KLF2) ELISA Kit
MBS2602107-04 10x 96 Well

Guinea pig Kruppel Like Factor 2 (KLF2) ELISA Kit

Sign In for Pricing
View Details