Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C17orf53 Rabbit Polyclonal Antibody (Biotin)

C17orf53 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MCM8IP, C17orf53

UniProt

Q8N3J3

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human C17orf53

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EVLRETARPQSSALHPLLTFESQQQQVGGFEGPEQDEFDKVLASMELEEP

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

INF2 Polyclonal Antibody
E-AB-90045-01 60 µL

INF2 Polyclonal Antibody

Sign In for Pricing
View Details
INF2 Polyclonal Antibody
E-AB-90045-02 120 µL

INF2 Polyclonal Antibody

Sign In for Pricing
View Details
INF2 Polyclonal Antibody
E-AB-90045-03 200 µL

INF2 Polyclonal Antibody

Sign In for Pricing
View Details
Human CLIC5 activation kit by CRISPRa
GA110014 1 Kit

Human CLIC5 activation kit by CRISPRa

Sign In for Pricing
View Details
Glucose 6 phosphate isomerase (GPI) Human Knockdown Lysate
LY300183 100 µg

Glucose 6 phosphate isomerase (GPI) Human Knockdown Lysate

Sign In for Pricing
View Details
TATA binding protein (TBP) (NM_003194) Human Over-expression Lysate
LY401105 100 µg

TATA binding protein (TBP) (NM_003194) Human Over-expression Lysate

Sign In for Pricing
View Details