Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C17orf53 Rabbit Polyclonal Antibody (FITC)

C17orf53 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MCM8IP, C17orf53

UniProt

Q8N3J3

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human C17orf53

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EVLRETARPQSSALHPLLTFESQQQQVGGFEGPEQDEFDKVLASMELEEP

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phenoxyacetic acid 98%
P07330-01 100 g

Phenoxyacetic acid 98%

Sign In for Pricing
View Details
Phenoxyacetic acid 98%
P07330-02 500 g

Phenoxyacetic acid 98%

Sign In for Pricing
View Details
Phenoxyacetic acid 98%
P07330-03 1000 g

Phenoxyacetic acid 98%

Sign In for Pricing
View Details
Recombinant Bacillus amyloliquefaciens Putative bacilysin exporter BacE (bacE), partial
MBS7093467 Inquire

Recombinant Bacillus amyloliquefaciens Putative bacilysin exporter BacE (bacE), partial

Sign In for Pricing
View Details
beta Catenin (CTNNB1) Mouse Monoclonal Antibody [Clone ID: OTI9H2]
TA502341S 30 µL

beta Catenin (CTNNB1) Mouse Monoclonal Antibody [Clone ID: OTI9H2]

Sign In for Pricing
View Details
Anti Mouse CD18 Flow Cytometry Monoclonal Clone M182 Biotin 100ug
IRTAMSCD18M182CBL100UG 100 µg

Anti Mouse CD18 Flow Cytometry Monoclonal Clone M182 Biotin 100ug

Sign In for Pricing
View Details