Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C17orf53 Rabbit Polyclonal Antibody (HRP)

C17orf53 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MCM8IP, C17orf53

UniProt

Q8N3J3

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human C17orf53

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EVLRETARPQSSALHPLLTFESQQQQVGGFEGPEQDEFDKVLASMELEEP

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PICALM Signaling Antibody Sampler Kit
HAK21026 1 Kit

PICALM Signaling Antibody Sampler Kit

Sign In for Pricing
View Details
FANCA Recombinant Rabbit Monoclonal Antibody [JE36-22]
HA721889 100 µL

FANCA Recombinant Rabbit Monoclonal Antibody [JE36-22]

Sign In for Pricing
View Details
CD47 (IAP/964), CF740 conjugate, 0.1mg/mL
BNC740964-500 1x 500 µL

CD47 (IAP/964), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FAM13A Antibody
KC-1597-01 50 μL

FAM13A Antibody

Sign In for Pricing
View Details
FAM13A Antibody
KC-1597-02 100 µL

FAM13A Antibody

Sign In for Pricing
View Details
FAM13A Antibody
KC-1597-03 1 mL

FAM13A Antibody

Sign In for Pricing
View Details