Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TEPSIN Rabbit Polyclonal Antibody (HRP)

TEPSIN Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Enthd2, RGD1307410

UniProt

G3V8Y7

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat RGD1307410

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LSFLHRLPILLKGTSDDDIPCPGYLFEEIAKISHESLGSSQCLLEYLLNR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

XP_340947

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DUSP4 (NM_057158) Human Recombinant Protein
TP315252M 100 µg

DUSP4 (NM_057158) Human Recombinant Protein

Sign In for Pricing
View Details
Goat anti-Rabbit IgG Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - Clear PS
MT26F4-aR 10x 96 Well Plates

Goat anti-Rabbit IgG Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - Clear PS

Sign In for Pricing
View Details
SEC61G (NM_001012456) Human Over-expression Lysate
LC422868 20 µg

SEC61G (NM_001012456) Human Over-expression Lysate

Sign In for Pricing
View Details
Human MBOAT2 activation kit by CRISPRa
GA115088 1 Kit

Human MBOAT2 activation kit by CRISPRa

Sign In for Pricing
View Details
ATF2 Recombinant Rabbit Monoclonal Antibody [SZ17-01]
ET1603-15 100 µL

ATF2 Recombinant Rabbit Monoclonal Antibody [SZ17-01]

Sign In for Pricing
View Details
Tcf7l2 Mouse Gene Knockout Kit (CRISPR)
KN517329 1 Kit

Tcf7l2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details