Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CALML6 Rabbit Polyclonal Antibody (Biotin)

CALML6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CAGLP

UniProt

Q8TD86

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CALML6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YHEKAQNQESELRAAFRVFDKEGKGYIDWNTLKYVLMNAGEPLNEVEAEQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_619650

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CASC3 (NM_007359) Human Tagged ORF Clone Lentiviral Particle
RC208495L4V 200 µL

CASC3 (NM_007359) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
NEK9 (Serine/Threonine-protein Kinase Nek9, Nercc1 Kinase, Never in Mitosis A-related Kinase 9, NimA-related Protein Kinase 9, NimA-related Kinase 8, Nek8, KIAA1995, NEK8, NERCC, DKFZp434D0935, MGC138306, MGC16714, NERCC1) (HRP)
130286-HRP 100 µL

NEK9 (Serine/Threonine-protein Kinase Nek9, Nercc1 Kinase, Never in Mitosis A-related Kinase 9, NimA-related Protein Kinase 9, NimA-related Kinase 8, Nek8, KIAA1995, NEK8, NERCC, DKFZp434D0935, MGC138306, MGC16714, NERCC1) (HRP)

Sign In for Pricing
View Details
GLUL Antibody / Glutamine Synthetase
V4762-20UG 20 µg

GLUL Antibody / Glutamine Synthetase

Sign In for Pricing
View Details
Myosin Light Chain Kinase (MYLK) Magnetic Fluorescence Assay Kit
MBS2156941-01 96 Tests

Myosin Light Chain Kinase (MYLK) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Myosin Light Chain Kinase (MYLK) Magnetic Fluorescence Assay Kit
MBS2156941-02 5x 96 Tests

Myosin Light Chain Kinase (MYLK) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Myosin Light Chain Kinase (MYLK) Magnetic Fluorescence Assay Kit
MBS2156941-03 10x 96 Tests

Myosin Light Chain Kinase (MYLK) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details