Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBWD2 Rabbit Polyclonal Antibody (HRP)

CBWD2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q8IUF1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CBWD2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DNHCMEVIRLKGLVSIKDKSQQVIVQGVHELYDLEETPVSWKDDTERTNR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_742000

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRX3 (IRXB1, Iroquois-class Homeodomain Protein IRX-3, Homeodomain Protein IRXB1, Iroquois Homeobox Protein 3, FLJ99187) (HRP)
MBS6383117-01 0.1 mL

IRX3 (IRXB1, Iroquois-class Homeodomain Protein IRX-3, Homeodomain Protein IRXB1, Iroquois Homeobox Protein 3, FLJ99187) (HRP)

Sign In for Pricing
View Details
IRX3 (IRXB1, Iroquois-class Homeodomain Protein IRX-3, Homeodomain Protein IRXB1, Iroquois Homeobox Protein 3, FLJ99187) (HRP)
MBS6383117-02 5x 0.1 mL

IRX3 (IRXB1, Iroquois-class Homeodomain Protein IRX-3, Homeodomain Protein IRXB1, Iroquois Homeobox Protein 3, FLJ99187) (HRP)

Sign In for Pricing
View Details
ELISA Kit For Probable G-protein coupled receptor 162
E6296m 96 Tests

ELISA Kit For Probable G-protein coupled receptor 162

Sign In for Pricing
View Details
Human KRTAP27-1 knockout cell line
ABC-KH8202 1 Vial

Human KRTAP27-1 knockout cell line

Sign In for Pricing
View Details
Recombinant Idiomarina loihiensis 10 kDa chaperonin (groS)
MBS1444660-01 0.02 mg (E-Coli)

Recombinant Idiomarina loihiensis 10 kDa chaperonin (groS)

Sign In for Pricing
View Details
Recombinant Idiomarina loihiensis 10 kDa chaperonin (groS)
MBS1444660-02 0.1 mg (E-Coli)

Recombinant Idiomarina loihiensis 10 kDa chaperonin (groS)

Sign In for Pricing
View Details