Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBWD2 Rabbit Polyclonal Antibody (Biotin)

CBWD2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q8IUF1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CBWD2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TFEVPGNAKEEHLNMFIQNLLWEKNVRNKDNHCMEVIRLKGLVSIKDKSQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_742000

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H2AFZ Protein Vector (Human) (pPB-C-His)
PV019109 500 ng

H2AFZ Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
3- (4-bromophenyl) -N- (2-indol-3-ylethyl) prop-2-enamide
ARB69593 250 mg

3- (4-bromophenyl) -N- (2-indol-3-ylethyl) prop-2-enamide

Sign In for Pricing
View Details
P53, Recombinant, Human, GST-Tag (Tumor Suppressor Protein, Oncogene Protein) discontinued. see 209129
P1001-32L4-01 2 µg

P53, Recombinant, Human, GST-Tag (Tumor Suppressor Protein, Oncogene Protein) discontinued. see 209129

Sign In for Pricing
View Details
P53, Recombinant, Human, GST-Tag (Tumor Suppressor Protein, Oncogene Protein) discontinued. see 209129
P1001-32L4-02 5 µg

P53, Recombinant, Human, GST-Tag (Tumor Suppressor Protein, Oncogene Protein) discontinued. see 209129

Sign In for Pricing
View Details
ACTL7B Protein Vector (Mouse) (pPM-C-His)
PV152077 500 ng

ACTL7B Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
EHHADH, CT (Peroxisomal Bifunctional Enzyme, PBE, PBFE, Enoyl-CoA Hydratase/3,2-trans-enoyl-CoA Isomerase, 3-hydroxyacyl-CoA Dehydrogenase, ECHD) (FITC) discontinued
E2216-30-FITC 200 µL

EHHADH, CT (Peroxisomal Bifunctional Enzyme, PBE, PBFE, Enoyl-CoA Hydratase/3,2-trans-enoyl-CoA Isomerase, 3-hydroxyacyl-CoA Dehydrogenase, ECHD) (FITC) discontinued

Sign In for Pricing
View Details