Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBWD2 Rabbit Polyclonal Antibody (FITC)

CBWD2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q8IUF1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CBWD2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TFEVPGNAKEEHLNMFIQNLLWEKNVRNKDNHCMEVIRLKGLVSIKDKSQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_742000

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HEY2 / Hairy/enhancer-of-split related with YRPW motif protein 2 ELISA Kit
MBS2905297-01 48 Well

Human HEY2 / Hairy/enhancer-of-split related with YRPW motif protein 2 ELISA Kit

Sign In for Pricing
View Details
Human HEY2 / Hairy/enhancer-of-split related with YRPW motif protein 2 ELISA Kit
MBS2905297-02 96 Well

Human HEY2 / Hairy/enhancer-of-split related with YRPW motif protein 2 ELISA Kit

Sign In for Pricing
View Details
Human HEY2 / Hairy/enhancer-of-split related with YRPW motif protein 2 ELISA Kit
MBS2905297-03 5x 96 Well

Human HEY2 / Hairy/enhancer-of-split related with YRPW motif protein 2 ELISA Kit

Sign In for Pricing
View Details
Human HEY2 / Hairy/enhancer-of-split related with YRPW motif protein 2 ELISA Kit
MBS2905297-04 10x 96 Well

Human HEY2 / Hairy/enhancer-of-split related with YRPW motif protein 2 ELISA Kit

Sign In for Pricing
View Details
TRAPPC2B Human Over-expression Lysate
orb1355700 100 µg

TRAPPC2B Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human VISTA/B7-H5/PD-1H Protein
NBP2-52255-0.05mg 0.05 mg

Recombinant Human VISTA/B7-H5/PD-1H Protein

Sign In for Pricing
View Details