Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC66 Rabbit Polyclonal Antibody (Biotin)

CCDC66 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CCDC66

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PLRTKTGHILKSTQDTCIGSEKLLQKKPVGSETSQAKGEKNGMTFSSTKD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

91kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_001012524

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NOTCH1, CT (Notch 1 homolog, Notch homolog 1, Notch homolog-1, Notch 1) (AP)
MBS6453016-01 0.1 mL

NOTCH1, CT (Notch 1 homolog, Notch homolog 1, Notch homolog-1, Notch 1) (AP)

Sign In for Pricing
View Details
NOTCH1, CT (Notch 1 homolog, Notch homolog 1, Notch homolog-1, Notch 1) (AP)
MBS6453016-02 5x 0.1 mL

NOTCH1, CT (Notch 1 homolog, Notch homolog 1, Notch homolog-1, Notch 1) (AP)

Sign In for Pricing
View Details
Rat Ischemia Modified Albumin (IMA) Mini Samples ELISA Kit
MBS2087626-01 24 Strip Well

Rat Ischemia Modified Albumin (IMA) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Rat Ischemia Modified Albumin (IMA) Mini Samples ELISA Kit
MBS2087626-02 48 Well

Rat Ischemia Modified Albumin (IMA) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Rat Ischemia Modified Albumin (IMA) Mini Samples ELISA Kit
MBS2087626-03 96 Well

Rat Ischemia Modified Albumin (IMA) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Rat Ischemia Modified Albumin (IMA) Mini Samples ELISA Kit
MBS2087626-04 5x 96 Well

Rat Ischemia Modified Albumin (IMA) Mini Samples ELISA Kit

Sign In for Pricing
View Details