Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ccdc85a Rabbit Polyclonal Antibody (FITC)

Ccdc85a Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RGD1311700

UniProt

D4ACT5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Ccdc85a

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YSGMNESTLSYVRQLEARVRQLEEENRMLPQATQNRSQPPTRNSSNMEKG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001178482

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRTAP3-1 (NM_031958) Human Over-expression Lysate
LS083896 100 µg

KRTAP3-1 (NM_031958) Human Over-expression Lysate

Sign In for Pricing
View Details
AGAP1 (CENTG2, GGAP1, KIAA1099, Centaurin, gamma 2, GTP-binding and GTPase-activating Protein 1, Arf GAP with GTP-binding Protein-like, ANK Repeat and PH domains 1)
MBS620181-01 0.1 mg

AGAP1 (CENTG2, GGAP1, KIAA1099, Centaurin, gamma 2, GTP-binding and GTPase-activating Protein 1, Arf GAP with GTP-binding Protein-like, ANK Repeat and PH domains 1)

Sign In for Pricing
View Details
AGAP1 (CENTG2, GGAP1, KIAA1099, Centaurin, gamma 2, GTP-binding and GTPase-activating Protein 1, Arf GAP with GTP-binding Protein-like, ANK Repeat and PH domains 1)
MBS620181-02 5x 0.1 mg

AGAP1 (CENTG2, GGAP1, KIAA1099, Centaurin, gamma 2, GTP-binding and GTPase-activating Protein 1, Arf GAP with GTP-binding Protein-like, ANK Repeat and PH domains 1)

Sign In for Pricing
View Details
RRM1 Rabbit pAb
orb2714621-01 50 µL

RRM1 Rabbit pAb

Sign In for Pricing
View Details
RRM1 Rabbit pAb
orb2714621-02 100 µL

RRM1 Rabbit pAb

Sign In for Pricing
View Details
Canine Thrombin Purified 250ug
ICNTHR250UG 50 µg

Canine Thrombin Purified 250ug

Sign In for Pricing
View Details