Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC85A Rabbit Polyclonal Antibody (HRP)

CCDC85A Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q96PX6

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CCDC85A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AMLDHSNLIREVNRRLQLHLGEIRGLKDINQKLQEDNQELRDLCCFLDDD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001073902

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eotaxin (CCL11, C-C Motif Chemokine 11, Eosinophil Chemotactic Protein, Small-inducible Cytokine A11, SCYA11, MGC22554) (HRP)
MBS6403493-01 0.1 mL

Eotaxin (CCL11, C-C Motif Chemokine 11, Eosinophil Chemotactic Protein, Small-inducible Cytokine A11, SCYA11, MGC22554) (HRP)

Sign In for Pricing
View Details
Eotaxin (CCL11, C-C Motif Chemokine 11, Eosinophil Chemotactic Protein, Small-inducible Cytokine A11, SCYA11, MGC22554) (HRP)
MBS6403493-02 5x 0.1 mL

Eotaxin (CCL11, C-C Motif Chemokine 11, Eosinophil Chemotactic Protein, Small-inducible Cytokine A11, SCYA11, MGC22554) (HRP)

Sign In for Pricing
View Details
ZW10 cDNA Clone
MBS1275757-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

ZW10 cDNA Clone

Sign In for Pricing
View Details
ZW10 cDNA Clone
MBS1275757-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

ZW10 cDNA Clone

Sign In for Pricing
View Details
ATP6V1A (NM_001690) Human Over-expression Lysate
LS000523-20ug 20 µg

ATP6V1A (NM_001690) Human Over-expression Lysate

Sign In for Pricing
View Details
PRKAR1B Recombinant Protein (Mouse)
RP164426 100 µg

PRKAR1B Recombinant Protein (Mouse)

Sign In for Pricing
View Details