Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC85A Rabbit Polyclonal Antibody (HRP)

CCDC85A Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q96PX6

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CCDC85A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AMLDHSNLIREVNRRLQLHLGEIRGLKDINQKLQEDNQELRDLCCFLDDD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001073902

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCR, alpha, beta (T Cell Receptor, T-cell Receptor beta-1 Chain C Region, TRBC1, T-cell Receptor alpha Chain C Region, TRAC, TCRA) (MaxLight 550)
T2040-02N-ML550 100 µL

TCR, alpha, beta (T Cell Receptor, T-cell Receptor beta-1 Chain C Region, TRBC1, T-cell Receptor alpha Chain C Region, TRAC, TCRA) (MaxLight 550)

Sign In for Pricing
View Details
PSMG4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1745508 1.0 µg DNA

PSMG4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Rabbit Anti DDX3X Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot,IHC,Immunofluorescence) 200ul
IRBAMLDDX3XAP035200UL 200 µL

Rabbit Anti DDX3X Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot,IHC,Immunofluorescence) 200ul

Sign In for Pricing
View Details
TUSC3 Antibody - N-terminal region : FITC (ARP74316_P050-FITC)
ARP74316_P050-FITC 100 µL

TUSC3 Antibody - N-terminal region : FITC (ARP74316_P050-FITC)

Sign In for Pricing
View Details
Recombinant Human Glutathione Peroxidase 2/GPX2 Protein
NBP1-78824-10ug 10 µg

Recombinant Human Glutathione Peroxidase 2/GPX2 Protein

Sign In for Pricing
View Details
Mouse Monoclonal MIG2/Kindlin-2 Antibody (3A3) [Janelia Fluor 646]
NBP3-14275JF646 0.1 mL

Mouse Monoclonal MIG2/Kindlin-2 Antibody (3A3) [Janelia Fluor 646]

Sign In for Pricing
View Details