Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDADC1 Rabbit Polyclonal Antibody (FITC)

CDADC1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

NYD-SP15, bA103J18.1

UniProt

Q9BWV3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CDADC1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EGVSKFTWQLNPSGAYGLEQNEPERRENGVLRPVPQKEEQHQDKKLRLGI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_112173

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Adenylate cyclase type 10/ADCY10 Protein, N-His
orb2961721-01 50 µg

Recombinant Human Adenylate cyclase type 10/ADCY10 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human Adenylate cyclase type 10/ADCY10 Protein, N-His
orb2961721-02 100 µg

Recombinant Human Adenylate cyclase type 10/ADCY10 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human Adenylate cyclase type 10/ADCY10 Protein, N-His
orb2961721-03 1 mg

Recombinant Human Adenylate cyclase type 10/ADCY10 Protein, N-His

Sign In for Pricing
View Details
Rat Ras-related protein Rab-7L1, RAB7L1 ELISA Kit
MBS9332532-01 48 Well

Rat Ras-related protein Rab-7L1, RAB7L1 ELISA Kit

Sign In for Pricing
View Details
Rat Ras-related protein Rab-7L1, RAB7L1 ELISA Kit
MBS9332532-02 96 Well

Rat Ras-related protein Rab-7L1, RAB7L1 ELISA Kit

Sign In for Pricing
View Details
Rat Ras-related protein Rab-7L1, RAB7L1 ELISA Kit
MBS9332532-03 5x 96 Well

Rat Ras-related protein Rab-7L1, RAB7L1 ELISA Kit

Sign In for Pricing
View Details