Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLEC14A Rabbit Polyclonal Antibody (FITC)

CLEC14A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CEG1, EGFR-5, C14orf27

UniProt

Q86T13

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CLEC14A

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SQPRKESMGPPGLESDPEPAALGSSSAHCTNNGVKVGDCDLRDRAEGALL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human

Tested Applications

WB

NCBI Accession Number

NP_778230

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Heat Shock Protein Beta-1 (HSPB1) ELISA Kit
abx151867-01 96 Tests

Human Heat Shock Protein Beta-1 (HSPB1) ELISA Kit

Sign In for Pricing
View Details
Human Heat Shock Protein Beta-1 (HSPB1) ELISA Kit
abx151867-02 5x 96 Tests

Human Heat Shock Protein Beta-1 (HSPB1) ELISA Kit

Sign In for Pricing
View Details
Human Heat Shock Protein Beta-1 (HSPB1) ELISA Kit
abx151867-03 10x 96 Tests

Human Heat Shock Protein Beta-1 (HSPB1) ELISA Kit

Sign In for Pricing
View Details
Mouse Complement Factor H ELISA Kit (Colorimetric)
NBP3-18770 1 Kit

Mouse Complement Factor H ELISA Kit (Colorimetric)

Sign In for Pricing
View Details
GAP43 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-0154R-BF555-01 20 µL

GAP43 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
GAP43 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-0154R-BF555-02 100 µL

GAP43 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details