Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INTS11 Rabbit Polyclonal Antibody (FITC)

INTS11 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RC68, INT11, RC-68, CPSF3L, CPSF73L

UniProt

Q5TA45

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human CPSF3L

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TESTYATTIRDSKRCRERDFLKKVHETVERGGKGAHEPEGAHLLLHGADR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001243385.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Aldo-keto reductase family 1 member C3 (AKR1C3) ELISA Kit
MBS2803272-01 48 Tests

Sheep Aldo-keto reductase family 1 member C3 (AKR1C3) ELISA Kit

Sign In for Pricing
View Details
Sheep Aldo-keto reductase family 1 member C3 (AKR1C3) ELISA Kit
MBS2803272-02 96 Tests

Sheep Aldo-keto reductase family 1 member C3 (AKR1C3) ELISA Kit

Sign In for Pricing
View Details
Sheep Aldo-keto reductase family 1 member C3 (AKR1C3) ELISA Kit
MBS2803272-03 5x 96 Tests

Sheep Aldo-keto reductase family 1 member C3 (AKR1C3) ELISA Kit

Sign In for Pricing
View Details
Sheep Aldo-keto reductase family 1 member C3 (AKR1C3) ELISA Kit
MBS2803272-04 10x 96 Tests

Sheep Aldo-keto reductase family 1 member C3 (AKR1C3) ELISA Kit

Sign In for Pricing
View Details
PIK3C2B Human Over-expression Lysate
orb1365458 20 µg

PIK3C2B Human Over-expression Lysate

Sign In for Pricing
View Details
ACTBP11 Protein Vector (Human) (pPM-C-HA)
PV060971 500 ng

ACTBP11 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details