Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXorf36 Rabbit Polyclonal Antibody (HRP)

CXorf36 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DIA1R, CXorf36, PRO3743, EPQL1862, bA435K1.1, 4930578C19Rik

UniProt

Q9H7Y0

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CXorf36

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DKQEGSQEANRAGENKDIFSCLVSGCQAQLPSCESISEKQSLVLVCQKLL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Mouse

Tested Applications

WB

NCBI Accession Number

NP_789789

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp345 Mouse siRNA Oligo Duplex (Locus ID 545471)
SR417405 1 Kit

Zfp345 Mouse siRNA Oligo Duplex (Locus ID 545471)

Sign In for Pricing
View Details
Cholic acid
GD0884-100g 100 g

Cholic acid

Sign In for Pricing
View Details
Recombinant Human NUBP1 Protein
E30P01806A 50 µg

Recombinant Human NUBP1 Protein

Sign In for Pricing
View Details
BTG4 (Protein BTG4, BTG Family Member 4, Protein PC3b, PC3B, MGC33003) (Biotin)
124043-Biotin 100 µL

BTG4 (Protein BTG4, BTG Family Member 4, Protein PC3b, PC3B, MGC33003) (Biotin)

Sign In for Pricing
View Details
3-Amino-4-Methyl-N- (4-Methyl-2-pyridyl) benzamide
orb3143500-01 5 mg

3-Amino-4-Methyl-N- (4-Methyl-2-pyridyl) benzamide

Sign In for Pricing
View Details
3-Amino-4-Methyl-N- (4-Methyl-2-pyridyl) benzamide
orb3143500-02 10 mg

3-Amino-4-Methyl-N- (4-Methyl-2-pyridyl) benzamide

Sign In for Pricing
View Details