Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXorf36 Rabbit Polyclonal Antibody (FITC)

CXorf36 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DIA1R, CXorf36, PRO3743, EPQL1862, bA435K1.1, 4930578C19Rik

UniProt

Q9H7Y0

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CXorf36

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GLDKCNACIGTSICKKFFKEEIRSDNWLASHLGLPPDSLLSYPANYSDDS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_789789

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGF11 (NM_004112) Human Over-expression Lysate
LY418205 100 µg

FGF11 (NM_004112) Human Over-expression Lysate

Sign In for Pricing
View Details
WNT11 Human Gene Knockout Kit (CRISPR)
KN419688 1 Kit

WNT11 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FHL1 Human Gene Knockout Kit (CRISPR)
KN203478RB 1 Kit

FHL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Amaranthus caudatus Lectin (Tassel flowerInca wheat) -ACA-
LA-8201-1 1 mg

Alkaline Phosphatase Conjugated Amaranthus caudatus Lectin (Tassel flowerInca wheat) -ACA-

Sign In for Pricing
View Details
CD4 Mouse Monoclonal Antibody [Clone ID: B486A1]
AM06077PU-N 100 µL

CD4 Mouse Monoclonal Antibody [Clone ID: B486A1]

Sign In for Pricing
View Details
Spectrin beta III (SPTBN2) (SPTBN2/1778), CF594 conjugate, 0.1mg/mL
BNC941778-100 1x 100 µL

Spectrin beta III (SPTBN2) (SPTBN2/1778), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details