Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGD1564541 Rabbit Polyclonal Antibody (HRP)

RGD1564541 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RGD1564541

UniProt

D4A067

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat RGD1564541

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GAVVKFGQGFGKTNIYTQKQEPPKKVMMTKRTKDMGKFSSVTVSTIDEEE

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001101420

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RHBDF1 activation kit by CRISPRa
GA112032 1 Kit

Human RHBDF1 activation kit by CRISPRa

Sign In for Pricing
View Details
Inositol Hexakisphosphate Kinase 2 (IP6K2) Mouse Monoclonal Antibody [Clone ID: OTI1F12]
CF808811 100 µg

Inositol Hexakisphosphate Kinase 2 (IP6K2) Mouse Monoclonal Antibody [Clone ID: OTI1F12]

Sign In for Pricing
View Details
H2BC19P Rabbit Monoclonal Antibody [Clone ID: R07-8K4]
TA384369 100 µL

H2BC19P Rabbit Monoclonal Antibody [Clone ID: R07-8K4]

Sign In for Pricing
View Details
FOLR1 Recombinant Rabbit Monoclonal Antibody [PSH06-94]
HA722769 100 µL

FOLR1 Recombinant Rabbit Monoclonal Antibody [PSH06-94]

Sign In for Pricing
View Details
AIF1 / Iba1 (Microglia Marker) (AIF1/2493), Biotin conjugate, 0.1mg/mL
BNCB2493-100 1x 100 µL

AIF1 / Iba1 (Microglia Marker) (AIF1/2493), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR562689 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details