Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DENND4C Rabbit Polyclonal Antibody (FITC)

DENND4C Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C9orf55, C9orf55B, RAB10GEF, bA513M16.3

UniProt

Q5VZ89

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human DENND4C

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KHNQIITEETGSAVEPSDEIKRASGDVQTMKISSVPNSLSKRNVSLTRSH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

87kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cops8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6286808 1.0 µg DNA

Cops8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Chicken AST (Aspartate Aminotransferase) ELISA Kit
MBS8807658-01 48 Well

Chicken AST (Aspartate Aminotransferase) ELISA Kit

Sign In for Pricing
View Details
Chicken AST (Aspartate Aminotransferase) ELISA Kit
MBS8807658-02 96 Well

Chicken AST (Aspartate Aminotransferase) ELISA Kit

Sign In for Pricing
View Details
Chicken AST (Aspartate Aminotransferase) ELISA Kit
MBS8807658-03 5x 96 Well

Chicken AST (Aspartate Aminotransferase) ELISA Kit

Sign In for Pricing
View Details
Chicken AST (Aspartate Aminotransferase) ELISA Kit
MBS8807658-04 10x 96 Well

Chicken AST (Aspartate Aminotransferase) ELISA Kit

Sign In for Pricing
View Details
TCL-1B5 Double Nickase Plasmid (m2)
sc-424253-NIC-2 20 µg

TCL-1B5 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details