Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DENND4C Rabbit Polyclonal Antibody (HRP)

DENND4C Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C9orf55, C9orf55B, RAB10GEF, bA513M16.3

UniProt

Q5VZ89

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human DENND4C

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KHNQIITEETGSAVEPSDEIKRASGDVQTMKISSVPNSLSKRNVSLTRSH

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

87kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Estradiol (E2) ELISA Kit
YP-W74018-01 48 Tests

Sheep Estradiol (E2) ELISA Kit

Sign In for Pricing
View Details
Sheep Estradiol (E2) ELISA Kit
YP-W74018-02 96 Tests

Sheep Estradiol (E2) ELISA Kit

Sign In for Pricing
View Details
BCRP/ABCG2 Rabbit pAb
APA3667-01 30 µL

BCRP/ABCG2 Rabbit pAb

Sign In for Pricing
View Details
BCRP/ABCG2 Rabbit pAb
APA3667-02 50 μL

BCRP/ABCG2 Rabbit pAb

Sign In for Pricing
View Details
BCRP/ABCG2 Rabbit pAb
APA3667-03 100 µL

BCRP/ABCG2 Rabbit pAb

Sign In for Pricing
View Details
CD316 (Immunoglobulin Superfamily member 8, CD81 partner 3, Glu-Trp-Ile EWI motif-containing protein 2, EWI-2, Keratinocytes-associated transmembrane protein 4, KCT-4, LIR-D1, IGSF8, CD81P3, EWI2, KCT4) (MaxLight 650)
MBS6221335-01 0.1 mL

CD316 (Immunoglobulin Superfamily member 8, CD81 partner 3, Glu-Trp-Ile EWI motif-containing protein 2, EWI-2, Keratinocytes-associated transmembrane protein 4, KCT-4, LIR-D1, IGSF8, CD81P3, EWI2, KCT4) (MaxLight 650)

Sign In for Pricing
View Details