Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DENND4C Rabbit Polyclonal Antibody (HRP)

DENND4C Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C9orf55, C9orf55B, RAB10GEF, bA513M16.3

UniProt

Q5VZ89

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human DENND4C

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KHNQIITEETGSAVEPSDEIKRASGDVQTMKISSVPNSLSKRNVSLTRSH

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

87kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

G6PC (Glucose-6-phosphatase, Glucose-6-Phosphatase, Catalytic Subunit)
481464 100 µL

G6PC (Glucose-6-phosphatase, Glucose-6-Phosphatase, Catalytic Subunit)

Sign In for Pricing
View Details
Rabbit TGF-beta1 ELISA Kit
orb568023-01 48 Tests

Rabbit TGF-beta1 ELISA Kit

Sign In for Pricing
View Details
Rabbit TGF-beta1 ELISA Kit
orb568023-02 96 Tests

Rabbit TGF-beta1 ELISA Kit

Sign In for Pricing
View Details
UAP1L1 Protein Vector (Mouse) (pPM-C-HA)
PV243380 500 ng

UAP1L1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Anti-Syntaxin 16 Rabbit Monoclonal Antibody, Carrier-free
M06602-carrier-free 100 µL

Anti-Syntaxin 16 Rabbit Monoclonal Antibody, Carrier-free

Sign In for Pricing
View Details
TBK1 Protein Vector (Mouse) (pPB-C-His)
PV236806 500 ng

TBK1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details