Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHX40 Rabbit Polyclonal Antibody (HRP)

DHX40 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PAD, DDX40, ARG147

UniProt

Q8IX18

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human DHX40

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KQLKDGISKDVLKKMQRRNDDKSISDARARFLERKQQRTQDHSDTRKETG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

86kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_078888

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Interleukin 33 ELISA Kit
MBS047286 Inquire

Rabbit Interleukin 33 ELISA Kit

Sign In for Pricing
View Details
Anti-Rat Acid sensitive Ion channel (ASIC1/BNaC2) IgG #1, Aff. Pure
ASIC11-A 100 µg

Anti-Rat Acid sensitive Ion channel (ASIC1/BNaC2) IgG #1, Aff. Pure

Sign In for Pricing
View Details
Chicken Sex-Determining Region Y Protein (SRY) ELISA Kit
MBS9361056 Inquire

Chicken Sex-Determining Region Y Protein (SRY) ELISA Kit

Sign In for Pricing
View Details
D-Lactic acid
4003254.1 1 g

D-Lactic acid

Sign In for Pricing
View Details
HMGN2P9 ORF Vector (Human) (pORF)
ORF021000 1.0 µg DNA

HMGN2P9 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Betacellulin (BTC, Probetacellulin) (MaxLight 750)
MBS6465228-01 0.1 mL

Betacellulin (BTC, Probetacellulin) (MaxLight 750)

Sign In for Pricing
View Details