Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHX40 Rabbit Polyclonal Antibody (HRP)

DHX40 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PAD, DDX40, ARG147

UniProt

Q8IX18

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human DHX40

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RRQEEGERSRDLQEERLSAVCIADREEKGCTSQEGGTTPTFPIQKQRKKI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

86kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_078888

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD137 / 4-1BB / TNFRSF9 (4-1BB/3201), CF640R conjugate, 0.1mg/mL
BNC403201-500 1x 500 µL

CD137 / 4-1BB / TNFRSF9 (4-1BB/3201), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Bone
CS642161 5x 5 µm

Frozen Tissue Sections, Bone

Sign In for Pricing
View Details
ACAT1 Mouse Monoclonal Antibody [Clone ID: AT15E5]
AM50027PU-S 50 µL

ACAT1 Mouse Monoclonal Antibody [Clone ID: AT15E5]

Sign In for Pricing
View Details
Aar2 Mouse Gene Knockout Kit (CRISPR)
KN500586 1 Kit

Aar2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BRCA1 Rabbit Polyclonal Antibody
AP02739PU-N 100 µL

BRCA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bid Recombinant Rabbit monoclonal Antibody
HA723593 100 µL

Bid Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details