Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPY19L3 Rabbit Polyclonal Antibody (FITC)

DPY19L3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q6ZPD9

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human DPY19L3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QMLQAPTLVQGFHGLIYDNKTESMKTINLLQRMNIYQEVFLSILYRVLPI

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

83kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_997208

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MOS Protein Lysate
MBS8415381-01 0.02 mg

Human MOS Protein Lysate

Sign In for Pricing
View Details
Human MOS Protein Lysate
MBS8415381-02 5x 0.02 mg

Human MOS Protein Lysate

Sign In for Pricing
View Details
Anti-P4HB Rabbit Monoclonal Antibody
MA4155-.05 50 µL

Anti-P4HB Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
ISPD sgRNA CRISPR Lentivector (Human) (Target 1)
K2775702 1.0 µg DNA

ISPD sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
USP16, ID (Ubiquitin Thiolesterase 16, Ubiquitin-specific Processing Protease 16, Deubiquitinating Enzyme 16, Ubiquitin Processing Protease UBP-M, MSTP039) (APC) discontinued
U4100-63B-APC 200 µL

USP16, ID (Ubiquitin Thiolesterase 16, Ubiquitin-specific Processing Protease 16, Deubiquitinating Enzyme 16, Ubiquitin Processing Protease UBP-M, MSTP039) (APC) discontinued

Sign In for Pricing
View Details
Mouse Mediator of RNA polymerase II transcription subunit 6 (MED6) ELISA Kit
abx532668 96 Tests

Mouse Mediator of RNA polymerase II transcription subunit 6 (MED6) ELISA Kit

Sign In for Pricing
View Details