Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPY19L3 Rabbit Polyclonal Antibody (HRP)

DPY19L3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q6ZPD9

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human DPY19L3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QMLQAPTLVQGFHGLIYDNKTESMKTINLLQRMNIYQEVFLSILYRVLPI

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

83kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_997208

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal enkurin Antibody (OTI6C10) [DyLight 755]
NBP2-72461IR 0.1 mL

Mouse Monoclonal enkurin Antibody (OTI6C10) [DyLight 755]

Sign In for Pricing
View Details
CaIPLA2 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-22878R-BF350 100 µL

CaIPLA2 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
ADH, Drosophila melanogaster
HY-P701937 1 Each

ADH, Drosophila melanogaster

Sign In for Pricing
View Details
FAM162A CRISPR All-in-one AAV vector set (with saCas9)(Rat)
19815156 3x 1.0 µg DNA

FAM162A CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
HOXD8 Antibody
E034743 100 µg -100 µL

HOXD8 Antibody

Sign In for Pricing
View Details
Rac-Cidofovir-d5 Diphosphate Trisodium
CS-T-96379 1 Each

Rac-Cidofovir-d5 Diphosphate Trisodium

Sign In for Pricing
View Details