Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPY19L3 Rabbit Polyclonal Antibody (HRP)

DPY19L3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q6ZPD9

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human DPY19L3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QMLQAPTLVQGFHGLIYDNKTESMKTINLLQRMNIYQEVFLSILYRVLPI

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

83kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_997208

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD2/CD2 Antibody Picoband® Fluoro488 Conjugated
PA1743-Fluoro488 100 µg/Vial

Anti-CD2/CD2 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
CNDP2 Protein (N-His, Human)
P502688 100 µg

CNDP2 Protein (N-His, Human)

Sign In for Pricing
View Details
Sheep V-type proton ATPase 16 kDa proteolipid subunit (ATP6V0C) ELISA Kit
MBS280153-01 48 Tests

Sheep V-type proton ATPase 16 kDa proteolipid subunit (ATP6V0C) ELISA Kit

Sign In for Pricing
View Details
Sheep V-type proton ATPase 16 kDa proteolipid subunit (ATP6V0C) ELISA Kit
MBS280153-02 96 Tests

Sheep V-type proton ATPase 16 kDa proteolipid subunit (ATP6V0C) ELISA Kit

Sign In for Pricing
View Details
Sheep V-type proton ATPase 16 kDa proteolipid subunit (ATP6V0C) ELISA Kit
MBS280153-03 5x 96 Tests

Sheep V-type proton ATPase 16 kDa proteolipid subunit (ATP6V0C) ELISA Kit

Sign In for Pricing
View Details
Sheep V-type proton ATPase 16 kDa proteolipid subunit (ATP6V0C) ELISA Kit
MBS280153-04 10x 96 Tests

Sheep V-type proton ATPase 16 kDa proteolipid subunit (ATP6V0C) ELISA Kit

Sign In for Pricing
View Details