Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFL1 Rabbit Polyclonal Antibody (Biotin)

EFL1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RIA1, SDS2, EFTUD1, FAM42A, HsT19294

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human EFTUD1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TTEEEYLHFGEKADSENQARKYMNAVRKRKGLYVEEKIVEHAEKQRTLSK

Field of Research

Cardiovascular Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

117kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001035700

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trypsin discontinued
T8669-10 1 mL

Trypsin discontinued

Sign In for Pricing
View Details
Recombinant Human Heat shock factor protein 2 (HSF2), Biotinylated
orb3006307-01 20 µg

Recombinant Human Heat shock factor protein 2 (HSF2), Biotinylated

Sign In for Pricing
View Details
Recombinant Human Heat shock factor protein 2 (HSF2), Biotinylated
orb3006307-02 100 µg

Recombinant Human Heat shock factor protein 2 (HSF2), Biotinylated

Sign In for Pricing
View Details
Recombinant Human Heat shock factor protein 2 (HSF2), Biotinylated
orb3006307-03 1 mg

Recombinant Human Heat shock factor protein 2 (HSF2), Biotinylated

Sign In for Pricing
View Details
IFN beta Blocking Peptide
orb706729-01 1 mg

IFN beta Blocking Peptide

Sign In for Pricing
View Details
IFN beta Blocking Peptide
orb706729-02 5 mg

IFN beta Blocking Peptide

Sign In for Pricing
View Details