Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFL1 Rabbit Polyclonal Antibody (FITC)

EFL1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RIA1, SDS2, EFTUD1, FAM42A, HsT19294

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human EFTUD1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TTEEEYLHFGEKADSENQARKYMNAVRKRKGLYVEEKIVEHAEKQRTLSK

Field of Research

Cardiovascular Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

117kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001035700

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOXB13 Rabbit pAb, PE-Cy5.5 conjugated
orb2867136 100 µL

HOXB13 Rabbit pAb, PE-Cy5.5 conjugated

Sign In for Pricing
View Details
MUC12 (Mucin 12, Cell Surface Associated, MUC11) (APC)
MBS6170162-01 0.1 mL

MUC12 (Mucin 12, Cell Surface Associated, MUC11) (APC)

Sign In for Pricing
View Details
MUC12 (Mucin 12, Cell Surface Associated, MUC11) (APC)
MBS6170162-02 5x 0.1 mL

MUC12 (Mucin 12, Cell Surface Associated, MUC11) (APC)

Sign In for Pricing
View Details
Anti-ASIC1 Antibody (N271/28)
RHF65202 100 μg

Anti-ASIC1 Antibody (N271/28)

Sign In for Pricing
View Details
GABA A Receptor alpha 1 (GABRA1) Human Over-expression Lysate
orb1341127 100 µg

GABA A Receptor alpha 1 (GABRA1) Human Over-expression Lysate

Sign In for Pricing
View Details
2-Biphenylyl Sulfate Potassium Salt
415591-01 50 mg

2-Biphenylyl Sulfate Potassium Salt

Sign In for Pricing
View Details