Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXD2 Rabbit Polyclonal Antibody (FITC)

EXD2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

EXDL2, C14orf114

UniProt

Q9NVH0

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human EXD2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SNWDAETLTEDQVIYAARDAQISVALFLHLLGYPFSRNSPGEKNDDHSSW

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_060669

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Cytochrome c oxidase subunit II ELISA kit
GTR10470166 96 Well

Chicken Cytochrome c oxidase subunit II ELISA kit

Sign In for Pricing
View Details
String Wound Cartridge, Cotton S.W.,5μm, High Dirt,40",28/63mm, DOE no-Endcap, SS Steel, No-Seal Mat, No supp, Rev.0
CFWCW0500D40ZBD4SOX0 1 Piece/Case:1 Piece/ PACKS:1 PACKS/CASE

String Wound Cartridge, Cotton S.W.,5μm, High Dirt,40",28/63mm, DOE no-Endcap, SS Steel, No-Seal Mat, No supp, Rev.0

Sign In for Pricing
View Details
CTNNB1 (Catenin (Cadherin-Associated Protein), beta 1, 88kD, CTNNB, DKFZp686D02253, FLJ25606, FLJ37923)
245062 100 µg

CTNNB1 (Catenin (Cadherin-Associated Protein), beta 1, 88kD, CTNNB, DKFZp686D02253, FLJ25606, FLJ37923)

Sign In for Pricing
View Details
Human Nei Endonuclease VIII Like Protein 1 (NEIL1) ELISA Kit
BSKH66121-01 48 Tests

Human Nei Endonuclease VIII Like Protein 1 (NEIL1) ELISA Kit

Sign In for Pricing
View Details
Human Nei Endonuclease VIII Like Protein 1 (NEIL1) ELISA Kit
BSKH66121-02 96 Tests

Human Nei Endonuclease VIII Like Protein 1 (NEIL1) ELISA Kit

Sign In for Pricing
View Details
Lamb3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6695705 3x 1.0 µg

Lamb3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details