Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXD2 Rabbit Polyclonal Antibody (FITC)

EXD2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

EXDL2, C14orf114

UniProt

Q9NVH0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human EXD2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NGEATESQQKPRNKKSKMDGMVPGNHQGRDPRKHKRKPLGVGYSARKSPL

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060669

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Heat Shock Protein 47 (HSP47, CBP2, AsTP3, CBP1, PIG14, RA-A47, SERPINH1, SERPINH2, Colligen, Gp46, Serpin Peptidase Inhibitor Clade H Member 1, Heat Shock Protein 47, Collagen Binding Protein 2)
369539 200 µL

Heat Shock Protein 47 (HSP47, CBP2, AsTP3, CBP1, PIG14, RA-A47, SERPINH1, SERPINH2, Colligen, Gp46, Serpin Peptidase Inhibitor Clade H Member 1, Heat Shock Protein 47, Collagen Binding Protein 2)

Sign In for Pricing
View Details
Nelfa Mouse shRNA Plasmid (Locus ID 24116)
TL513378 1 Kit

Nelfa Mouse shRNA Plasmid (Locus ID 24116)

Sign In for Pricing
View Details
Mouse vitronectin, VNR ELISA KIT
E1409Mo-01 48 Well

Mouse vitronectin, VNR ELISA KIT

Sign In for Pricing
View Details
Mouse vitronectin, VNR ELISA KIT
E1409Mo-02 96 Well

Mouse vitronectin, VNR ELISA KIT

Sign In for Pricing
View Details
Mouse vitronectin, VNR ELISA KIT
E1409Mo-03 5x 96 Tests

Mouse vitronectin, VNR ELISA KIT

Sign In for Pricing
View Details
Mouse vitronectin, VNR ELISA KIT
E1409Mo-04 10x 96 Tests

Mouse vitronectin, VNR ELISA KIT

Sign In for Pricing
View Details