Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAHD1 Rabbit Polyclonal Antibody (HRP)

FAHD1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

YISKL, C16orf36

UniProt

B1AK40

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human FAHD1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EAAAMDYVGGYALCLDMTARDVQDECKKKGLPWTLAKSFTASCPVSAFVP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001018114

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cecr2 Mouse shRNA Plasmid (Locus ID 330409)
TR518798 1 Kit

Cecr2 Mouse shRNA Plasmid (Locus ID 330409)

Sign In for Pricing
View Details
TPM4 Antibody
43002 100 µL

TPM4 Antibody

Sign In for Pricing
View Details
SyntabuLin (SYBU) (NM_001099744) Human Tagged ORF Clone
RC217887 10 µg

SyntabuLin (SYBU) (NM_001099744) Human Tagged ORF Clone

Sign In for Pricing
View Details
ZNF418 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2704906 1.0 µg DNA

ZNF418 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
S100A6 293 Cell Lysate
407144 0.1 mg

S100A6 293 Cell Lysate

Sign In for Pricing
View Details
Albumin, Human Serum (HSA, ALB, Analbuminemia, DKFZp779N1935, Dysalbuminemic Hyperthyroxinemia, Growth Inhibiting Protein 20, Hyperthyroxinemia Dysalbuminemic, PRO0883, PRO0903, PRO1341, PRO2044, PRO2619) discontinued
A1327-02J 50 µg

Albumin, Human Serum (HSA, ALB, Analbuminemia, DKFZp779N1935, Dysalbuminemic Hyperthyroxinemia, Growth Inhibiting Protein 20, Hyperthyroxinemia Dysalbuminemic, PRO0883, PRO0903, PRO1341, PRO2044, PRO2619) discontinued

Sign In for Pricing
View Details