Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FERMT1 Rabbit Polyclonal Antibody (Biotin)

FERMT1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

URP1, KIND1, DTGCU2, UNC112A, C20orf42

UniProt

Q49AC8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human FERMT1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VIEFDQNVFTAFTCLSADCKIVHEYIGGYIFLSTRSKDQNETLDEDLFHK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Forkhead box protein O3 ELISA Kit
MBS762485-01 48 Well

Human Forkhead box protein O3 ELISA Kit

Sign In for Pricing
View Details
Human Forkhead box protein O3 ELISA Kit
MBS762485-02 96 Well

Human Forkhead box protein O3 ELISA Kit

Sign In for Pricing
View Details
Human Forkhead box protein O3 ELISA Kit
MBS762485-03 5x 96 Well

Human Forkhead box protein O3 ELISA Kit

Sign In for Pricing
View Details
Human Forkhead box protein O3 ELISA Kit
MBS762485-04 10x 96 Well

Human Forkhead box protein O3 ELISA Kit

Sign In for Pricing
View Details
PDXP Peptide - N-terminal region
orb2003736 100 µg

PDXP Peptide - N-terminal region

Sign In for Pricing
View Details
ATPIF1 Rabbit Polyclonal Antibody
orb155764-01 50 μL

ATPIF1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details