Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FERMT1 Rabbit Polyclonal Antibody (HRP)

FERMT1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

URP1, KIND1, DTGCU2, UNC112A, C20orf42

UniProt

Q49AC8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human FERMT1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VIEFDQNVFTAFTCLSADCKIVHEYIGGYIFLSTRSKDQNETLDEDLFHK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPET1 Polyclonal Antibody, PE-Cy7 Conjugated
bs-0188R-PE-Cy7 100 µL

PPET1 Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
NT5C1A Antibody, HRP conjugated
A67457-50UG 50 µg

NT5C1A Antibody, HRP conjugated

Sign In for Pricing
View Details
MXD4 Antibody
orb1315159-01 30 µL

MXD4 Antibody

Sign In for Pricing
View Details
MXD4 Antibody
orb1315159-02 50 μL

MXD4 Antibody

Sign In for Pricing
View Details
MXD4 Antibody
orb1315159-03 100 µL

MXD4 Antibody

Sign In for Pricing
View Details
Human PNKD Protein Lysate
MBS8417444-01 0.02 mg

Human PNKD Protein Lysate

Sign In for Pricing
View Details